H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000430771 Accession number: AK311905 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Histone H3.3;
 
 

Motif information
ORF

length(136),orf(129:539)
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALR
EIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*
a.a.
length
InterPro Name
length(136), motif(1:136) 136 IPR000164 Histone H3/CENP-A [Family]
length(133), motif(2:134) 133 IPR009072 Histone-fold [Domain]
length(132), motif(2:133) 132 IPR009072 Histone-fold [Domain]
length(15), motif(3:17) 15 IPR000164 Histone H3/CENP-A [Family]
length(7), motif(15:21) 7 IPR000164 Histone H3/CENP-A [Family]
length(15), motif(17:31) 15 IPR000164 Histone H3/CENP-A [Family]
length(103), motif(34:136) 103 IPR000164 Histone H3/CENP-A [Family]
length(22), motif(34:55) 22 IPR000164 Histone H3/CENP-A [Family]
length(75), motif(58:132) 75 IPR007125 Histone core [Domain]
length(18), motif(58:75) 18 IPR000164 Histone H3/CENP-A [Family]
length(9), motif(67:75) 9 IPR000164 Histone H3/CENP-A [Family]
length(19), motif(80:98) 19 IPR000164 Histone H3/CENP-A [Family]
length(17), motif(98:114) 17 IPR000164 Histone H3/CENP-A [Family]
length(22), motif(114:135) 22 IPR000164 Histone H3/CENP-A [Family]