H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000431205 Accession number: AK312339 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Poly [ADP-ribose] polymerase 1; PARP-1; EC=2.4.2.30; ADP-ribosyltransferase diphtheria toxin-like 1; ARTD1; NAD(+) ADP-ribosyltransferase 1; ADPRT 1; Poly[ADP-ribose] synthase 1;
 
 

Transcript original information
Accession number AK312339.1
CAGE tag ID NA
EST ID NA
Clone Number BRACE3048746
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PARP1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PARP1);
Sequence data provider NA
Annotation project NA
Length of cDNA 3132[bp] (No. of exon:23)[A:873 T:634 G:894 C:731]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type cerebellum
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0023551
Genomic location  G-integra Help Chromosome 1
Location 1q42.12
Position 226549161- 226595717
Strand -
Possible duplicated location(s) NA
Gene structure 23 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:142
KEGG GENES KEGG GENES(142)
GeneCard GeneCardPARP1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000197820
Predicted CDS 88..3132;  1014[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.785

Motif information
ORF

length(1014),orf(88:3132)
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPH
WYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD
GIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQ
LGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLP
GVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKD
ELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKV
KKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGK
LSRNKDEVKAMIEKLGGKLTGTANKASLCSSTKKEVEKMNKKMEEVKEAN
IRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSG
AALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGG
KVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKRFYPLEIDYGQDEE
AVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK
LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPP
LLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD
IKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKP
FKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKG
LGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLK
...
a.a.
length
InterPro Name
length(99), motif(2:100) 99 IPR001510 Zinc finger, PARP-type [Domain]
length(85), motif(9:93) 85 IPR001510 Zinc finger, PARP-type [Domain]
length(78), motif(12:89) 78 IPR001510 Zinc finger, PARP-type [Domain]
length(36), motif(21:56) 36 IPR001510 Zinc finger, PARP-type [Domain]
length(107), motif(108:214) 107 IPR001510 Zinc finger, PARP-type [Domain]
length(91), motif(113:203) 91 IPR001510 Zinc finger, PARP-type [Domain]
length(84), motif(116:199) 84 IPR001510 Zinc finger, PARP-type [Domain]
length(38), motif(125:162) 38 IPR001510 Zinc finger, PARP-type [Domain]
length(54), motif(279:332) 54 IPR012982 PADR1 [Domain]
length(77), motif(385:461) 77 IPR001357 BRCT domain [Domain]
length(85), motif(386:470) 85 IPR001357 BRCT domain [Domain]
length(80), motif(387:466) 80 IPR001357 BRCT domain [Domain]
length(79), motif(387:465) 79 IPR001357 BRCT domain [Domain]
length(74), motif(388:461) 74 IPR001357 BRCT domain [Domain]
length(124), motif(520:643) 124 IPR008893 WGR domain [Domain]
length(80), motif(550:629) 80 IPR008893 WGR domain [Domain]
length(81), motif(553:633) 81 IPR008893 WGR domain [Domain]
length(66), motif(562:627) 66 IPR008893 WGR domain [Domain]
length(165), motif(633:797) 165 IPR004102 Poly(ADP-ribose) polymerase, regulatory domain [Domain]
length(118), motif(662:779) 118 IPR004102 Poly(ADP-ribose) polymerase, regulatory domain [Domain]
length(137), motif(662:798) 137 IPR004102 Poly(ADP-ribose) polymerase, regulatory domain [Domain]
length(134), motif(662:795) 134 IPR004102 Poly(ADP-ribose) polymerase, regulatory domain [Domain]
length(227), motif(788:1014) 227 IPR012317 Poly(ADP-ribose) polymerase, catalytic domain [Domain]
length(211), motif(797:1007) 211 IPR012317 Poly(ADP-ribose) polymerase, catalytic domain [Domain]
length(210), motif(799:1008) 210 IPR012317 Poly(ADP-ribose) polymerase, catalytic domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000431205
H-Inv cluster ID Locus viewHIX0023551
Accession number AK312339.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Poly [ADP-ribose] polymerase 1; PARP-1; EC=2.4.2.30; ADP-ribosyltransferase diphtheria toxin-like 1; ARTD1; NAD(+) ADP-ribosyltransferase 1; ADPRT 1; Poly[ADP-ribose] synthase 1;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P09874)  [Identity/coverage = 99.803%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 15055172108670210932221217352123876212526925131742824474289113931134203120710312133293158519518481104674061504438315489334167104141690425716959974171779761739615017525332181725001866964819344625196088611966137919690332197794552006823120106667212694602140669221577210217999112200210622863007ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PARP1
HGNC aliases "ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)", "poly (ADP-ribose) polymerase family, member 1"
HGNC name poly (ADP-ribose) polymerase 1
DDBJ NA
UniProt PARP1
EC number EC 2.4.2.30NAD+ ADP-ribosyltransferase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000197820
No. of interaction 11
Interaction partner(s) HIP000000536HIP000034440HIP000034929HIP000046967HIP000051773HIP000052053HIP000058172HIP000072699HIP000107046HIP000137439HIP000141753
BIND 144659;  178699;  183793;  258937;  258941; 
DIP 104000E;  115604E;  116694E;  119E;  142998E;  179393E;  180047E;  184905E;  184906E;  40132E;  74463E;  785E;  82408E; 
MINT MINT-16977;  MINT-16978;  MINT-4790085;  MINT-4790102;  MINT-4790124;  MINT-48090;  MINT-48220;  MINT-48757;  MINT-48954;  MINT-49557;  MINT-49605;  MINT-51143;  MINT-51144;  MINT-7026649;  MINT-7026658;  MINT-7294936;  MINT-7914712;  MINT-7947479;  MINT-7986069;  MINT-7986078;  MINT-7986091;  MINT-7986107;  MINT-7986121;  MINT-7986299;  MINT-7986313;  MINT-7986327;  MINT-7986354;  MINT-7986369;  MINT-7986386;  MINT-7986404;  MINT-8086548; 
HPRD 00289;  00298;  00313;  00314;  00476;  00535;  00536;  00589;  00596;  00977;  01045;  01071;  01238;  01239;  01241;  01245;  01246;  01250;  01260;  01305;  01412;  01456;  01577;  01606;  01806;  01859;  01909;  02416;  02765;  02799;  02941;  02966;  03011;  03247;  03465;  03538;  03554;  03780;  03833;  04115;  04116;  04167;  04184;  04284;  04302;  04412;  04462;  04761;  05189;  05212;  05442;  05599;  06370;  06769;  06910;  07038;  08935;  09113;  09660;  09848;  10378;  11485;  13624;  18043; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:142
KEGG GENES KEGG GENES(142)
GeneCard GeneCardPARP1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function zinc ion binding (GO:0008270);  DNA binding (GO:0003677);  NAD+ ADP-ribosyltransferase activity (GO:0003950); 
Biological process protein amino acid ADP-ribosylation (GO:0006471); 
Cellular component nucleus (GO:0005634); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
1 110 1uw0A 7e-28 29.0 107/117 g.39.1.12
112 218 1uw0A 2e-18 26.1 105/117 g.39.1.12
387 471 1wf6A 6e-07 16.7 84/132 c.15.1.5
518 643 2cr9A1 6e-46 99.2 126/126 d.297.1.1
662 794 1gs0A1 3e-48 37.3 126/128 a.41.1.1
797 997 1a26A2 3e-77 87.1 201/216 d.166.1.2
Related H-InvDB links GTOP GTOP

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name:NA
Related information in OMIM OMIM ID:  173870;  Title: POLY(ADP-RIBOSE) POLYMERASE 1
Co-localized orphan diseases NA
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(142)
Disease Entrez Gene ID:(142)
Substance Entrez Gene ID:(142)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
40 .. 40 T/C rs200785577 - 5'UTR
41 .. 41 A/G rs199833781 - 5'UTR
71 .. 71 G/C rs907187 + 5'UTR
82 .. 82 G/C rs11541662 + 5'UTR
101 .. 101 C/G rs201256399 - CDS Nonsynonymous[Ser5Trp]
202 .. 202 G/C rs142025196 - CDS Nonsynonymous[Val39Leu]
215 .. 215 T/C rs202022212 - CDS Nonsynonymous[Met43Thr]
249 .. 249 C/G rs3738708 + CDS Nonsynonymous[Phe54Leu]
302 .. 302 A/C rs147105590 - CDS Nonsynonymous[Asp72Ala]
310 .. 310 T/C rs182219056 - CDS Nonsynonymous[Ser75Pro]
320 .. 320 G/A rs139202063 - CDS Nonsynonymous[Arg78Gln]
321 .. 321 G/A rs200181050 - CDS Synonymous[Arg78Arg]
330 .. 330 C/T rs1805404 + CDS Synonymous[Asp81Asp]
351 .. 351 A/G rs200812750 - CDS Synonymous[Thr88Thr]
354 .. 354 G/A rs201586576 - CDS Synonymous[Ala89Ala]
414 .. 414 T/A rs199783084 - CDS Synonymous[Thr109Thr]
426 .. 426 T/C rs61750986 - CDS Synonymous[Phe113Phe]
435 .. 435 G/A rs182943999 - CDS Synonymous[Glu116Glu]
442 .. 442 A/G rs143431455 - CDS Nonsynonymous[Lys119Glu]
449 .. 449 A/G rs200370133 - CDS Nonsynonymous[Asn121Ser]
457 .. 457 A/G rs139924814 - CDS Nonsynonymous[Thr124Ala]
459 .. 459 G/A rs199514247 - CDS Synonymous[Thr124Thr]
473 .. 473 T/C rs201841505 - CDS Nonsynonymous[Met129Thr]
499 .. 499 C/T rs193238922 - CDS Nonsynonymous[Arg138Cys]
537 .. 537 G/T rs142376976 - CDS Nonsynonymous[Gln150His]
569 .. 569 G/T rs144252227 - CDS Nonsynonymous[Gly161Val]
604 .. 604 C/T rs147537486 - CDS Nonsynonymous[Arg173Trp]
605 .. 605 G/A rs200399922 - CDS Nonsynonymous[Arg173Gln]
609 .. 609 C/G rs13306125 + CDS Synonymous[Pro174Pro]
620 .. 620 C/T rs202057244 - CDS Nonsynonymous[Ala178Val]
628 .. 628 C/T rs113258217 - CDS Nonsynonymous[Leu181Phe]
649 .. 649 G/A rs1805409 + CDS Nonsynonymous[Ala188Thr]
652 .. 652 A/G rs143482147 - CDS Nonsynonymous[Thr189Ala]
681 .. 681 G/A rs146652447 - CDS Synonymous[Gln198Gln]
734 .. 734 T/C rs144925873 - CDS Nonsynonymous[Val216Ala]
743 .. 743 T/C rs149927756 - CDS Nonsynonymous[Val219Ala]
746 .. 746 C/T rs139232092 - CDS Nonsynonymous[Ala220Val]
808 .. 808 C/G rs151069237 - CDS Nonsynonymous[Gln241Glu]
814 .. 814 G/A rs200470832 - CDS Nonsynonymous[Asp243Asn]
830 .. 830 T/C rs111635488 - CDS Nonsynonymous[Ile248Thr]
846 .. 846 G/T rs139912909 - CDS Nonsynonymous[Lys253Asn]
853 .. 853 T/C rs202234597 - CDS Nonsynonymous[Cys256Arg]
872 .. 872 A/G rs61750985 - CDS Nonsynonymous[Lys262Arg]
879 .. 879 A/C rs201080980 - CDS Synonymous[Leu264Leu]
917 .. 917 C/T rs201975538 - CDS Nonsynonymous[Ser277Leu]
920 .. 920 C/T rs201777393 - CDS Nonsynonymous[Ala278Val]
933 .. 933 A/G rs147456215 - CDS Synonymous[Arg282Arg]
939 .. 939 T/C rs1805414 + CDS Synonymous[Ala284Ala]
945 .. 945 C/T rs180691231 - CDS Synonymous[Gly286Gly]
954 .. 954 C/T rs200757349 - CDS Synonymous[Phe289Phe]
964 .. 964 C/T rs149619679 - CDS Nonsynonymous[Leu293Phe]
968 .. 968 C/T rs138017860 - CDS Nonsynonymous[Pro294Leu]
983 .. 983 C/T rs141200001 - CDS Nonsynonymous[Ser299Leu]
997 .. 997 T/C rs200557411 - CDS Nonsynonymous[Phe304Leu]
1026 ^ 1027 -/G rs34723923 - CDS
1029 .. 1029 C/T rs61750984 - CDS Synonymous[Asp314Asp]
1060 .. 1060 A/G rs146522827 - CDS Nonsynonymous[Thr325Ala]
1080 .. 1080 G/A rs145545176 - CDS Synonymous[Lys331Lys]
1081 .. 1081 G/T rs150021518 - CDS AA-STOP[Glu332*]
1087 .. 1087 G/A rs3219057 + CDS Nonsynonymous[Val334Ile]
1090 .. 1090 A/T rs150693561 - CDS Nonsynonymous[Thr335Ser]
1097 .. 1097 A/G rs191733508 - CDS Nonsynonymous[Lys337Arg]
1143 .. 1143 G/A/C rs1805415 + CDS
1170 .. 1170 C/T rs201783835 - CDS Synonymous[Thr361Thr]
1188 .. 1188 C/T rs142852413 - CDS Synonymous[Ala367Ala]
1201 .. 1201 T/C rs200129594 - CDS Nonsynonymous[Ser372Pro]
1216 .. 1216 C/T rs2230484 + CDS Nonsynonymous[Pro377Ser]
1233 .. 1233 C/G rs138576809 - CDS Synonymous[Ser382Ser]
1235 .. 1235 C/A rs3219062 + CDS Nonsynonymous[Ser383Tyr]
1290 .. 1290 G/T rs79858762 - CDS Synonymous[Leu401Leu]
1295 .. 1295 G/A rs150379323 - CDS Nonsynonymous[Arg403Gln]
1310 .. 1310 T/G rs79529505 - CDS Nonsynonymous[Val408Gly]
1332 .. 1332 C/T rs61731503 - CDS Synonymous[Leu415Leu]
1358 .. 1358 A/G rs147711929 - CDS Nonsynonymous[Asn424Ser]
1360 .. 1360 A/G rs142346536 - CDS Nonsynonymous[Lys425Glu]
1406 .. 1406 A/G rs145185569 - CDS Nonsynonymous[Asn440Ser]
1441 .. 1441 C/A rs139399785 - CDS Synonymous[Arg452Arg]
1458 .. 1458 C/T rs143814826 - CDS Synonymous[Asp457Asp]
1461 .. 1461 C/T rs61731501 - CDS Synonymous[Phe458Phe]
1477 .. 1477 G/A rs149332554 - CDS Nonsynonymous[Ala464Thr]
1512 .. 1512 G/A rs138653264 - CDS Synonymous[Ala475Ala]
1529 .. 1529 G/C rs138072805 - CDS Nonsynonymous[Trp481Ser]
1530 .. 1530 G/C rs201371549 - CDS Nonsynonymous[Trp481Cys]
1592 .. 1592 C/T rs183533639 - CDS Nonsynonymous[Ala502Val]
1675 .. 1675 G/A rs146636298 - CDS Nonsynonymous[Gly530Arg]
1686 .. 1686 G/T rs200491303 - CDS Synonymous[Val533Val]
1714 .. 1714 G/A rs200485374 - CDS Nonsynonymous[Ala543Thr]
1716 .. 1716 G/A rs116547814 - CDS Synonymous[Ala543Ala]
1763 .. 1763 T/C rs201365502 - CDS Nonsynonymous[Leu559Pro]
1764 .. 1764 G/T rs201124419 - CDS Synonymous[Leu559Leu]
1787 .. 1787 A/G rs201570154 - CDS Nonsynonymous[Asn567Ser]
1801 .. 1801 C/T rs148920242 - CDS Synonymous[Leu572Leu]
1819 .. 1819 G/A rs140136106 - CDS Nonsynonymous[Asp578Asn]
1907 .. 1907 A/C rs146121136 - CDS Nonsynonymous[Lys607Thr]
1926 .. 1926 C/G rs1059011 + CDS Nonsynonymous[His613Gln]
1947 .. 1947 A/G rs139083979 - CDS Synonymous[Glu620Glu]
1953 .. 1953 C/T rs148181159 - CDS Synonymous[Thr622Thr]
1959 .. 1959 C/T rs147221209 - CDS Synonymous[Asn624Asn]
1961 .. 1961 C/T rs146978206 - CDS Nonsynonymous[Ala625Val]
1982 .. 1982 C/T rs138228205 - CDS Nonsynonymous[Thr632Met]
1983 .. 1983 G/A rs200966933 - CDS Synonymous[Thr632Thr]
2001 .. 2001 C/T rs13306137 + CDS Synonymous[Phe638Phe]
2078 .. 2078 A/G rs145186011 - CDS Nonsynonymous[Lys664Arg]
2085 .. 2085 C/T rs74683779 - CDS Synonymous[Pro666Pro]
2109 .. 2109 G/A rs145512649 - CDS Synonymous[Lys674Lys]
2141 .. 2141 C/T rs145719349 - CDS Nonsynonymous[Ala685Val]
2169 .. 2169 G/A rs13306138 + CDS Synonymous[Gln694Gln]
2179 .. 2179 T/C rs139484215 - CDS Synonymous[Leu698Leu]
2262 .. 2262 C/T rs13306119 + CDS Synonymous[Ser725Ser]
2314 .. 2314 G/A rs201652970 - CDS Nonsynonymous[Asp743Asn]
2337 .. 2337 G/A rs200978353 - CDS Synonymous[Pro750Pro]
2371 .. 2371 G/C rs199498180 - CDS Nonsynonymous[Val762Leu]
2372 .. 2372 T/C rs1136410 + CDS Nonsynonymous[Val762Ala]
2373 .. 2373 G/A rs200801740 - CDS Synonymous[Val762Val]
2453 .. 2453 C/T rs139753887 - CDS Nonsynonymous[Pro789Leu]
2457 .. 2457 C/T/A rs148234314 - CDS
2527 .. 2527 A/G rs200630156 - CDS Nonsynonymous[Ile814Val]
2557 .. 2557 A/G rs149375401 - CDS Nonsynonymous[Thr824Ala]
2562 .. 2562 A/G rs138839443 - CDS Synonymous[Thr825Thr]
2567 .. 2567 A/G rs1136420 + CDS Nonsynonymous[Asn827Ser]
2570 .. 2570 C/T rs147825810 - CDS Nonsynonymous[Ala828Val]
2571 .. 2571 G/A rs140555704 - CDS Synonymous[Ala828Ala]
2589 .. 2589 C/T rs142137883 - CDS Synonymous[Ile834Ile]
2616 .. 2616 C/T rs148631906 - CDS Synonymous[Gly843Gly]
2623 .. 2623 C/A rs186612310 - CDS Nonsynonymous[Gln846Lys]
2627 .. 2627 G/A rs182639036 - CDS Nonsynonymous[Arg847His]
2657 .. 2657 G/A rs190105316 - CDS Nonsynonymous[Arg857Gln]
2732 .. 2732 C/T rs11541664 + CDS Nonsynonymous[Pro882Leu]
2739 .. 2739 G/A rs202143014 - CDS Synonymous[Ala884Ala]
2779 .. 2779 G/T/A rs139425386 - CDS
2802 .. 2802 C/T rs115098026 - CDS Synonymous[Ala905Ala]
2810 .. 2810 G/A rs1059040 + CDS Nonsynonymous[Cys908Tyr]
2813 .. 2813 A/G rs149314007 - CDS Nonsynonymous[His909Arg]
2828 .. 2828 A/G rs187041817 - CDS Nonsynonymous[Asp914Gly]
2837 .. 2837 G/C rs61731502 - CDS Nonsynonymous[Gly917Ala]
2838 .. 2838 C/G rs149424805 - CDS Synonymous[Gly917Gly]
2844 .. 2844 C/T rs139592583 - CDS Synonymous[Ile919Ile]
2876 .. 2876 A/G rs189410139 - CDS Nonsynonymous[Tyr930Cys]
2880 .. 2880 A/G rs199842726 - CDS Synonymous[Glu931Glu]
2906 .. 2906 A/G rs3219145 + CDS Nonsynonymous[Lys940Arg]
2953 .. 2953 C/T rs78381515 - CDS Nonsynonymous[Pro956Ser]
2978 .. 2978 T/C rs201340386 - CDS Nonsynonymous[Leu964Pro]
2990 .. 2990 A/G rs199689226 - CDS Nonsynonymous[Asp968Gly]
2993 .. 2993 T/C rs201004247 - CDS Nonsynonymous[Val969Ala]
3002 .. 3002 G/A rs201506704 - CDS Nonsynonymous[Gly972Glu]
3042 .. 3042 A/G rs138175519 - CDS Synonymous[Leu985Leu]
3091 .. 3091 C/T rs149006175 - CDS Synonymous[Leu1002Leu]
3124 .. 3124 C/A rs138906127 - CDS Nonsynonymous[Leu1013Met]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer