H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000431205 Accession number: AK312339 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Poly [ADP-ribose] polymerase 1; PARP-1; EC=2.4.2.30; ADP-ribosyltransferase diphtheria toxin-like 1; ARTD1; NAD(+) ADP-ribosyltransferase 1; ADPRT 1; Poly[ADP-ribose] synthase 1;
 
 

Motif information
ORF

length(1014),orf(88:3132)
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPH
WYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD
GIGSKAEKTLGDFAAEYAKSNRSTCKGCMEKIEKGQVRLSKKMVDPEKPQ
LGMIDRWYHPGCFVKNREELGFRPEYSASQLKGFSLLATEDKEALKKQLP
GVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKAQNDLIWNIKD
ELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKV
KKQDRIFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGK
LSRNKDEVKAMIEKLGGKLTGTANKASLCSSTKKEVEKMNKKMEEVKEAN
IRVVSEDFLQDVSASTKSLQELFLAHILSPWGAEVKAEPVEVVAPRGKSG
AALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLEHSAHVLEKGG
KVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKRFYPLEIDYGQDEE
AVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGK
LSKRQIQAAYSILSEVQQAVSQGSSDSQILDLSNRFYTLIPHDFGMKKPP
LLNNADSVQAKVEMLDNLLDIEVAYSLLRGGSDDSSKDPIDVNYEKLKTD
IKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKP
FKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKG
LGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLK
...
a.a.
length
InterPro Name
length(99), motif(2:100) 99 IPR001510 Zinc finger, PARP-type [Domain]
length(85), motif(9:93) 85 IPR001510 Zinc finger, PARP-type [Domain]
length(78), motif(12:89) 78 IPR001510 Zinc finger, PARP-type [Domain]
length(36), motif(21:56) 36 IPR001510 Zinc finger, PARP-type [Domain]
length(107), motif(108:214) 107 IPR001510 Zinc finger, PARP-type [Domain]
length(91), motif(113:203) 91 IPR001510 Zinc finger, PARP-type [Domain]
length(84), motif(116:199) 84 IPR001510 Zinc finger, PARP-type [Domain]
length(38), motif(125:162) 38 IPR001510 Zinc finger, PARP-type [Domain]
length(54), motif(279:332) 54 IPR012982 PADR1 [Domain]
length(77), motif(385:461) 77 IPR001357 BRCT domain [Domain]
length(85), motif(386:470) 85 IPR001357 BRCT domain [Domain]
length(80), motif(387:466) 80 IPR001357 BRCT domain [Domain]
length(79), motif(387:465) 79 IPR001357 BRCT domain [Domain]
length(74), motif(388:461) 74 IPR001357 BRCT domain [Domain]
length(124), motif(520:643) 124 IPR008893 WGR domain [Domain]
length(80), motif(550:629) 80 IPR008893 WGR domain [Domain]
length(81), motif(553:633) 81 IPR008893 WGR domain [Domain]
length(66), motif(562:627) 66 IPR008893 WGR domain [Domain]
length(165), motif(633:797) 165 IPR004102 Poly(ADP-ribose) polymerase, regulatory domain [Domain]
length(118), motif(662:779) 118 IPR004102 Poly(ADP-ribose) polymerase, regulatory domain [Domain]
length(137), motif(662:798) 137 IPR004102 Poly(ADP-ribose) polymerase, regulatory domain [Domain]
length(134), motif(662:795) 134 IPR004102 Poly(ADP-ribose) polymerase, regulatory domain [Domain]
length(227), motif(788:1014) 227 IPR012317 Poly(ADP-ribose) polymerase, catalytic domain [Domain]
length(211), motif(797:1007) 211 IPR012317 Poly(ADP-ribose) polymerase, catalytic domain [Domain]
length(210), motif(799:1008) 210 IPR012317 Poly(ADP-ribose) polymerase, catalytic domain [Domain]