H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000431515 Accession number: AK312649 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Prohibitin;
 
 

Transcript original information
Accession number AK312649.1
CAGE tag ID NA
EST ID NA
Clone Number IMR322012034
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PHB) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PHB);
Sequence data provider NA
Annotation project NA
Length of cDNA 892[bp] (No. of exon:7)[A:207 T:193 G:266 C:226]
Devision HTC
Molecular type mRNA
Library origin Cell type neuroblastoma
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0013960
Genomic location  G-integra Help Chromosome 17
Location 17q21.33
Position 47482354- 47492242
Strand -
Possible duplicated location(s) NA
Gene structure 7 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5245
KEGG GENES KEGG GENES(5245)
GeneCard GeneCardPHB*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000022572
Predicted CDS 74..892;  272[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.79
Database links RefSeq NP_002625
UniProt P35232Q3T165
CCDS CCDS11548

Motif information
ORF

length(272),orf(74:892)
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVV
GEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVA
SQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQV
SDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV
EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQ
LSRSRNITYLPAGQSVLLQLPQ*
a.a.
length
InterPro Name
length(272), motif(1:272) 272 IPR000163 Prohibitin [Family]
length(162), motif(26:187) 162 IPR001107 Band 7 protein [Family]
length(178), motif(29:206) 178 IPR001107 Band 7 protein [Family]
length(17), motif(70:86) 17 IPR000163 Prohibitin [Family]
length(20), motif(88:107) 20 IPR000163 Prohibitin [Family]
length(19), motif(111:129) 19 IPR000163 Prohibitin [Family]
length(17), motif(134:150) 17 IPR000163 Prohibitin [Family]
length(20), motif(157:176) 20 IPR000163 Prohibitin [Family]
length(24), motif(182:205) 24 IPR000163 Prohibitin [Family]
length(17), motif(205:221) 17 IPR000163 Prohibitin [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000431515
H-Inv cluster ID Locus viewHIX0013960
Accession number AK312649.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Prohibitin;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P35232)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 154097382443941130269115489334196088612126946021746876ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PHB
HGNC aliases NA
HGNC name prohibitin
DDBJ NA
UniProt PHB
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000022572
No. of interaction 4
Interaction partner(s) HIP000025121HIP000027929HIP000027929HIP000346184
BIND 54912;  54913; 
DIP 180174E;  40205E;  40206E;  40208E; 
MINT MINT-48916;  MINT-6488590;  MINT-6488791;  MINT-7717355;  MINT-7717366;  MINT-7717378;  MINT-7717859;  MINT-8079030; 
HPRD 00017;  00032;  00312;  00494;  01061;  01241;  01248;  01265;  01574;  01576;  01778;  01803;  01806;  01859;  02091;  02483;  02533;  02911;  03143;  03723;  03975;  04285;  04459;  06659;  06763;  06942;  07038;  07601;  08201;  09006;  09690;  09803;  09918;  10355;  10584;  14358;  16246; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:5245
KEGG GENES KEGG GENES(5245)
GeneCard GeneCardPHB*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Cellular component membrane (GO:0016020); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  mitochondria;  nuclear;  Other; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
62 180 1winA 2e-19 6.7 119/100 d.43.2.1
Related H-InvDB links GTOP GTOP

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:27-May-2015
Disease relation Disease name:NA
Related information in OMIM OMIM ID:  176705;  Title: PROHIBITIN
Co-localized orphan diseases NA
Disease related mutation MutationView:  176705
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(5245)
Disease Entrez Gene ID:(5245)
Substance Entrez Gene ID:(5245)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
2 .. 2 G/C rs7501500 - 5'UTR
122 .. 122 G/T rs11658876 - CDS Nonsynonymous[Ala17Ser]
166 .. 166 T/G rs150024312 - CDS Nonsynonymous[Asp31Glu]
201 .. 201 G/T rs2233665 + CDS Nonsynonymous[Arg43Leu]
202 .. 202 T/G rs147481037 - CDS Synonymous[Arg43Arg]
225 .. 225 G/T rs201359263 - CDS Nonsynonymous[Gly51Val]
336 .. 336 T/C rs121918373 + CDS Nonsynonymous[Val88Ala]
370 .. 370 C/T rs144654469 - CDS Synonymous[Val99Val]
387 .. 387 G/A rs121918372 + CDS Nonsynonymous[Arg105His]
396 .. 396 C/G rs199792568 - CDS Nonsynonymous[Thr108Ser]
405 .. 405 G/A rs1049515 + CDS Nonsynonymous[Gly111Glu]
412 .. 412 C/T rs1049517 + CDS Synonymous[Asp113Asp]
499 .. 499 G/A rs1049525 + CDS Synonymous[Gln142Gln]
517 .. 517 G/T rs140693016 - CDS Nonsynonymous[Arg148Ser]
547 .. 547 C/T rs201875820 - CDS Synonymous[Ala158Ala]
597 .. 597 T/G rs150607417 - CDS Nonsynonymous[Phe175Cys]
598 .. 598 C/T rs191710304 - CDS Synonymous[Phe175Phe]
613 .. 613 A/G rs141363200 - CDS Synonymous[Thr180Thr]
619 .. 619 G/A rs148262252 - CDS Synonymous[Ala182Ala]
721 .. 721 C/T rs144040543 - CDS Synonymous[Gly216Gly]
751 .. 751 C/T rs149508639 - CDS Synonymous[Asn226Asn]
781 .. 781 C/T rs142883213 - CDS Synonymous[Ile236Ile]
782 .. 782 G/A rs137958073 - CDS Nonsynonymous[Glu237Lys]
826 .. 826 C/T rs2233670 + CDS Synonymous[Leu251Leu]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer