H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000432528 Accession number: AK313662 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Potassium voltage-gated channel subfamily A member 4; HPCN2; Voltage-gated K(+) channel HuKII; Voltage-gated potassium channel HBK4; Voltage-gated potassium channel HK1; Voltage-gated potassium channel subunit Kv1.4;
 
 

Transcript original information
Accession number AK313662.1
CAGE tag ID NA
EST ID NA
Clone Number BRAWH3003671
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (KCNA4) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (KCNA4);
Sequence data provider NA
Annotation project NA
Length of cDNA 2482[bp] (No. of exon:1)[A:616 T:630 G:656 C:580]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type brain
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0036152
Genomic location  G-integra Help Chromosome 11
Location 11p14.1
Position 30032264- 30034745
Strand -
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard GeneCardKCNA4*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000198360
Predicted CDS 1085..2482;  465[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.787

Motif information
ORF

length(465),orf(1085:2482)
TQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSG
GRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENE
FKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDL
VMALSAGGHGGLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVV
RCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAM
SFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIG
VILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGK
IVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPY
LPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSET
DKNNCSNAKAVETDV*
a.a.
length
InterPro Name
length(458), motif(1:458) 458 IPR028325 Voltage-gated potassium channel [Family]
length(85), motif(1:85) 85 IPR011333 BTB/POZ fold [Domain]
length(84), motif(1:84) 84 IPR011333 BTB/POZ fold [Domain]
length(78), motif(1:78) 78 IPR003131 Potassium channel tetramerisation-type BTB domain [Domain]
length(12), motif(17:28) 12 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(11), motif(30:40) 11 IPR003968 Potassium channel, voltage dependent, Kv [Family]
length(20), motif(30:49) 20 IPR003091 Potassium channel [Family]
length(11), motif(31:41) 11 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(12), motif(74:85) 12 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(166), motif(101:266) 166 IPR027359 Voltage-dependent channel, four helix bundle domain [Domain]
length(17), motif(109:125) 17 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(29), motif(112:140) 29 IPR003091 Potassium channel [Family]
length(12), motif(132:143) 12 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(187), motif(185:371) 187 IPR005821 Ion transport domain [Domain]
length(24), motif(185:208) 24 IPR003091 Potassium channel [Family]
length(21), motif(211:231) 21 IPR003091 Potassium channel [Family]
length(27), motif(260:286) 27 IPR003091 Potassium channel [Family]
length(9), motif(265:273) 9 IPR003968 Potassium channel, voltage dependent, Kv [Family]
length(15), motif(289:303) 15 IPR003968 Potassium channel, voltage dependent, Kv [Family]
length(24), motif(289:312) 24 IPR003091 Potassium channel [Family]
length(23), motif(320:342) 23 IPR003091 Potassium channel [Family]
length(27), motif(349:375) 27 IPR003091 Potassium channel [Family]
length(12), motif(360:371) 12 IPR003968 Potassium channel, voltage dependent, Kv [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000432528
H-Inv cluster ID Locus viewHIX0036152
Accession number AK313662.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Potassium voltage-gated channel subfamily A member 4; HPCN2; Voltage-gated K(+) channel HuKII; Voltage-gated potassium channel HBK4; Voltage-gated potassium channel HK1; Voltage-gated potassium channel subunit Kv1.4;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P22459)  [Identity/coverage = 99.847%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 20017942263489900007816554811ALL
Gene family/group Gene family H-Inv gene family/group ID HIF0000043
Gene family/group name Potassium channel, voltage dependent, Kv, tetramerisation (IPR003131).
Evidence motif (InterPro) ID 3
Gene symbol/name HGNC symbol KCNA4
HGNC aliases "potassium voltage-gated channel, shaker-related subfamily, member 4-like", "potassium voltage-gated channel, shaker-related subfamily, member 4"
HGNC name potassium channel, voltage gated shaker related subfamily A, member 4
DDBJ NA
UniProt KCNA4
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000198360
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard GeneCardKCNA4*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Potassium channel, voltage dependent, Kv, tetramerisation (IPR003131). Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
FR ID FR075205
Accession
Description
Location
PMID
FR ID FR302520
Accession
Description
Location
PMID

Gene ontology information
Molecular function voltage-gated potassium channel activity (GO:0005249);  ion channel activity (GO:0005216); 
Biological process ion transport (GO:0006811);  protein homooligomerization (GO:0051260);  potassium ion transport (GO:0006813); 
Cellular component membrane (GO:0016020);  voltage-gated potassium channel complex (GO:0008076); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT plasma membrane; 
Target P Other
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
3 72 1a68A 2e-07 80.0 70/87 d.42.1.2
266 282 1p7bA2 5e-04 5.9 17/100 f.14.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL endocrine_exocrine; 
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 NA
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
146 .. 146 C/T rs114096060 - 5'UTR
180 .. 180 A/C rs12419942 - 5'UTR
278 .. 278 C/G rs150400771 - 5'UTR
519 .. 519 C/A rs187120792 - 5'UTR
577 .. 577 T/C rs45616635 - 5'UTR
673 .. 673 C/A rs60942363 - 5'UTR
733 .. 733 T/C rs201582811 - 5'UTR
746 .. 746 C/G rs202168576 - 5'UTR
807 .. 807 A/G rs201817148 - 5'UTR
932 .. 932 G/A rs200269029 - 5'UTR
972 .. 972 G/A rs41282920 - 5'UTR
982 .. 982 G/A rs75865707 - 5'UTR
1189 .. 1189 G/A rs201159519 - CDS Synonymous[Arg35Arg]
1252 .. 1252 A/G rs181655275 - CDS Synonymous[Pro56Pro]
1336 .. 1336 C/T rs45509498 - CDS Synonymous[Asp84Asp]
1555 .. 1555 C/T rs3802914 + CDS Synonymous[Gly157Gly]
1576 .. 1576 T/C rs151268149 - CDS Synonymous[Asn164Asn]
1589 .. 1589 C/A rs12276475 - CDS Nonsynonymous[Pro169Thr]
1607 .. 1607 G/A rs191521585 - CDS Nonsynonymous[Gly175Arg]
1681 .. 1681 G/T rs202177146 - CDS Synonymous[Val199Val]
1705 .. 1705 C/G rs199748253 - CDS Nonsynonymous[Ser207Arg]
1780 .. 1780 C/T rs200158908 - CDS Synonymous[Gly232Gly]
1791 .. 1791 C/T rs200479133 - CDS Nonsynonymous[Ala236Val]
1797 ^ 1798 -/A rs36059154 - CDS
1812 .. 1812 A/G rs199975003 - CDS Nonsynonymous[Asn243Ser]
2123 .. 2123 G/T rs201134414 - CDS Nonsynonymous[Val347Leu]
2140 .. 2140 C/T rs201513098 - CDS Synonymous[Val352Val]
2263 .. 2263 G/A rs199569433 - CDS Synonymous[Gln393Gln]
2272 .. 2272 C/T rs140083893 - CDS Synonymous[Val396Val]
2344 .. 2344 G/C rs200225575 - CDS Nonsynonymous[Lys420Asn]
2395 .. 2395 G/C rs200767735 - CDS Nonsynonymous[Lys437Asn]
2409 .. 2409 A/G rs200498416 - CDS Nonsynonymous[Gln442Arg]
2439 .. 2439 A/G rs201531731 - CDS Nonsynonymous[Lys452Arg]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer