H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000432528 Accession number: AK313662 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Potassium voltage-gated channel subfamily A member 4; HPCN2; Voltage-gated K(+) channel HuKII; Voltage-gated potassium channel HBK4; Voltage-gated potassium channel HK1; Voltage-gated potassium channel subunit Kv1.4;
 
 

Motif information
ORF

length(465),orf(1085:2482)
TQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSG
GRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENE
FKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDL
VMALSAGGHGGLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVV
RCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAM
SFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIG
VILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGK
IVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPY
LPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSET
DKNNCSNAKAVETDV*
a.a.
length
InterPro Name
length(458), motif(1:458) 458 IPR028325 Voltage-gated potassium channel [Family]
length(85), motif(1:85) 85 IPR011333 BTB/POZ fold [Domain]
length(84), motif(1:84) 84 IPR011333 BTB/POZ fold [Domain]
length(78), motif(1:78) 78 IPR003131 Potassium channel tetramerisation-type BTB domain [Domain]
length(12), motif(17:28) 12 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(11), motif(30:40) 11 IPR003968 Potassium channel, voltage dependent, Kv [Family]
length(20), motif(30:49) 20 IPR003091 Potassium channel [Family]
length(11), motif(31:41) 11 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(12), motif(74:85) 12 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(166), motif(101:266) 166 IPR027359 Voltage-dependent channel, four helix bundle domain [Domain]
length(17), motif(109:125) 17 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(29), motif(112:140) 29 IPR003091 Potassium channel [Family]
length(12), motif(132:143) 12 IPR003972 Potassium channel, voltage dependent, Kv1 [Family]
length(187), motif(185:371) 187 IPR005821 Ion transport domain [Domain]
length(24), motif(185:208) 24 IPR003091 Potassium channel [Family]
length(21), motif(211:231) 21 IPR003091 Potassium channel [Family]
length(27), motif(260:286) 27 IPR003091 Potassium channel [Family]
length(9), motif(265:273) 9 IPR003968 Potassium channel, voltage dependent, Kv [Family]
length(15), motif(289:303) 15 IPR003968 Potassium channel, voltage dependent, Kv [Family]
length(24), motif(289:312) 24 IPR003091 Potassium channel [Family]
length(23), motif(320:342) 23 IPR003091 Potassium channel [Family]
length(27), motif(349:375) 27 IPR003091 Potassium channel [Family]
length(12), motif(360:371) 12 IPR003968 Potassium channel, voltage dependent, Kv [Family]