H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000484991 Accession number: EU515155 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Dysferlin; Dystrophy-associated fer-1-like protein; Fer-1-like protein 1;
 
 

Motif information
ORF

length(2111),orf(278:6613)
MLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGF
EWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSAS
FNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDV
VAGGGQSRAETWSLLSDSTMDTRYSGKKWPAPTDTGGEEDTEDQGLTGDE
AEPFLDQSGGPGAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQD
FQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFFN
LFDSPGELFDEPIFITVVDSRSLRTDALLGEFRMDVGTIYREPRHAYLRK
WLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSEDKEDIESNLL
RPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPF
VEVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRL
THNDIVATTYLSMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFG
PCYINLYGSPREFTGFPDPYTELNTGKGEGVAYRGRLLLSLETKLVEHSE
QKVEDLPADDILRVEKYLRRRKYSLFAAFYSATMLQDVDDAIQFEVSIGN
YGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDIS
HRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAG
CSQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAAL
EQAEDWLLRLRALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRR
GANYCGKNCGKLQTIFLKYPMEKVPGARMPVQIRVKLWFGLSVDEKEFNQ
FAEGKLSVFAETYENETKLALVGNWGTTGLTYPKFSDVTGKIKLPKDSFR
PSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRLPGGQWIYMS
...
a.a.
length
InterPro Name
length(100), motif(1:100) 100 IPR000008 C2 domain [Domain]
length(123), motif(1:123) 123 IPR000008 C2 domain [Domain]
length(138), motif(1:138) 138 IPR000008 C2 domain [Domain]
length(85), motif(1:85) 85 IPR000008 C2 domain [Domain]
length(84), motif(2:85) 84 IPR000008 C2 domain [Domain]
length(138), motif(238:375) 138 IPR000008 C2 domain [Domain]
length(134), motif(246:379) 134 IPR000008 C2 domain [Domain]
length(97), motif(252:348) 97 IPR000008 C2 domain [Domain]
length(82), motif(252:333) 82 IPR000008 C2 domain [Domain]
length(79), motif(254:332) 79 IPR000008 C2 domain [Domain]
length(72), motif(334:405) 72 IPR012968 FerIin domain [Domain]
length(14), motif(363:376) 14 IPR000008 C2 domain [Domain]
length(112), motif(408:519) 112 IPR000008 C2 domain [Domain]
length(115), motif(411:525) 115 IPR000008 C2 domain [Domain]
length(113), motif(411:523) 113 IPR000008 C2 domain [Domain]
length(96), motif(414:509) 96 IPR000008 C2 domain [Domain]
length(97), motif(414:510) 97 IPR000008 C2 domain [Domain]
length(66), motif(725:790) 66 IPR012560 Ferlin A-domain [Domain]
length(76), motif(817:892) 76 IPR012561 Ferlin B-domain [Domain]
length(60), motif(905:964) 60 IPR006614 Peroxin/Ferlin domain [Domain]
length(57), motif(977:1033) 57 IPR006614 Peroxin/Ferlin domain [Domain]
length(96), motif(980:1075) 96 IPR010482 Peroxin/Dysferlin domain [Domain]
length(39), motif(1042:1080) 39 IPR006614 Peroxin/Ferlin domain [Domain]
length(34), motif(1099:1132) 34 IPR006614 Peroxin/Ferlin domain [Domain]
length(144), motif(1167:1310) 144 IPR000008 C2 domain [Domain]
length(106), motif(1170:1275) 106 IPR000008 C2 domain [Domain]
length(126), motif(1181:1306) 126 IPR000008 C2 domain [Domain]
length(109), motif(1184:1292) 109 IPR000008 C2 domain [Domain]
length(90), motif(1185:1274) 90 IPR000008 C2 domain [Domain]
length(120), motif(1344:1463) 120 IPR000008 C2 domain [Domain]
length(88), motif(1367:1454) 88 IPR000008 C2 domain [Domain]
length(100), motif(1369:1468) 100 IPR000008 C2 domain [Domain]
length(82), motif(1371:1452) 82 IPR000008 C2 domain [Domain]
length(120), motif(1594:1713) 120 IPR000008 C2 domain [Domain]
length(99), motif(1596:1694) 99 IPR000008 C2 domain [Domain]
length(106), motif(1602:1707) 106 IPR000008 C2 domain [Domain]
length(100), motif(1610:1709) 100 IPR000008 C2 domain [Domain]
length(82), motif(1612:1693) 82 IPR000008 C2 domain [Domain]
length(25), motif(1797:1821) 25 IPR000008 C2 domain [Domain]
length(158), motif(1811:1968) 158 IPR000008 C2 domain [Domain]
length(197), motif(1827:2023) 197 IPR000008 C2 domain [Domain]
length(130), motif(1843:1972) 130 IPR000008 C2 domain [Domain]
length(24), motif(1933:1956) 24 IPR000008 C2 domain [Domain]