H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000484993 Accession number: EU515157 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Dysferlin; Dystrophy-associated fer-1-like protein; Fer-1-like protein 1;
 
 

Motif information
ORF

length(2101),orf(278:6583)
MLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGF
EWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSAS
FNAPLLDTKKQPTGASLVLQVSYTPLPGAVPLFPPPTPLEPSPTLPDLDV
VADTGGEEDTEDQGLTGDEAEPFLDQSGGPGAPTTPRKLPSRPPPHYPGI
KRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTK
RTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGE
FRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEA
PLERKDPSEDKEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMD
NVKQIFGFESNKKNLVDPFVEVSFAGKMLCSKILEKTANPQWNQNITLPA
MFPSMCEKMRIRIIDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGAV
KPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYTELNTGKGEGV
AYRGRLLLSLETKLVEHSEQKVEDLPADDILRVEKYLRRRKYSLFAAFYS
ATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYL
PWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQC
STEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQ
ITEAALALKLGHSELPAALEQAEDWLLRLRALAEEPQNSLPDIVIWMLQG
DKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPMEKVPGARMPV
QIRVKLWFGLSVDEKEFNQFAEGKLSVFAETYENETKLALVGNWGTTGLT
YPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFV
EEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWS
...
a.a.
length
InterPro Name
length(85), motif(1:85) 85 IPR000008 C2 domain [Domain]
length(138), motif(1:138) 138 IPR000008 C2 domain [Domain]
length(100), motif(1:100) 100 IPR000008 C2 domain [Domain]
length(123), motif(1:123) 123 IPR000008 C2 domain [Domain]
length(84), motif(2:85) 84 IPR000008 C2 domain [Domain]
length(138), motif(207:344) 138 IPR000008 C2 domain [Domain]
length(134), motif(215:348) 134 IPR000008 C2 domain [Domain]
length(97), motif(221:317) 97 IPR000008 C2 domain [Domain]
length(82), motif(221:302) 82 IPR000008 C2 domain [Domain]
length(79), motif(223:301) 79 IPR000008 C2 domain [Domain]
length(72), motif(303:374) 72 IPR012968 FerIin domain [Domain]
length(14), motif(332:345) 14 IPR000008 C2 domain [Domain]
length(112), motif(377:488) 112 IPR000008 C2 domain [Domain]
length(113), motif(380:492) 113 IPR000008 C2 domain [Domain]
length(115), motif(380:494) 115 IPR000008 C2 domain [Domain]
length(96), motif(383:478) 96 IPR000008 C2 domain [Domain]
length(97), motif(383:479) 97 IPR000008 C2 domain [Domain]
length(66), motif(694:759) 66 IPR012560 Ferlin A-domain [Domain]
length(76), motif(786:861) 76 IPR012561 Ferlin B-domain [Domain]
length(60), motif(874:933) 60 IPR006614 Peroxin/Ferlin domain [Domain]
length(57), motif(946:1002) 57 IPR006614 Peroxin/Ferlin domain [Domain]
length(96), motif(949:1044) 96 IPR010482 Peroxin/Dysferlin domain [Domain]
length(39), motif(1011:1049) 39 IPR006614 Peroxin/Ferlin domain [Domain]
length(34), motif(1068:1101) 34 IPR006614 Peroxin/Ferlin domain [Domain]
length(144), motif(1136:1279) 144 IPR000008 C2 domain [Domain]
length(106), motif(1139:1244) 106 IPR000008 C2 domain [Domain]
length(126), motif(1150:1275) 126 IPR000008 C2 domain [Domain]
length(109), motif(1153:1261) 109 IPR000008 C2 domain [Domain]
length(90), motif(1154:1243) 90 IPR000008 C2 domain [Domain]
length(120), motif(1313:1432) 120 IPR000008 C2 domain [Domain]
length(88), motif(1336:1423) 88 IPR000008 C2 domain [Domain]
length(100), motif(1338:1437) 100 IPR000008 C2 domain [Domain]
length(82), motif(1340:1421) 82 IPR000008 C2 domain [Domain]
length(120), motif(1584:1703) 120 IPR000008 C2 domain [Domain]
length(99), motif(1586:1684) 99 IPR000008 C2 domain [Domain]
length(106), motif(1592:1697) 106 IPR000008 C2 domain [Domain]
length(100), motif(1600:1699) 100 IPR000008 C2 domain [Domain]
length(82), motif(1602:1683) 82 IPR000008 C2 domain [Domain]
length(25), motif(1787:1811) 25 IPR000008 C2 domain [Domain]
length(158), motif(1801:1958) 158 IPR000008 C2 domain [Domain]
length(197), motif(1817:2013) 197 IPR000008 C2 domain [Domain]
length(130), motif(1833:1962) 130 IPR000008 C2 domain [Domain]
length(24), motif(1923:1946) 24 IPR000008 C2 domain [Domain]