H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000487603 Accession number: AB451390 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Heterogeneous nuclear ribonucleoprotein K isoform a.
 
 

Transcript original information
Accession number AB451390.1
CAGE tag ID NA
EST ID NA
Clone Number FLJ08080AAAF
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 1392[bp] (No. of exon:14)[A:400 T:334 G:356 C:302]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0008131
Genomic location  G-integra Help Chromosome 9
Location 9q21.32
Position 86584325- 86593167
Strand -
Possible duplicated location(s) NA
Gene structure 14 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3190
KEGG GENES KEGG GENES(3190)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000051001
Predicted CDS 1..1392;  464[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.738
Database links RefSeq NP_002131NP_112553
UniProt Q4R4M6Q5R5H8
CCDS CCDS6668

Motif information
ORF

length(464),orf(1:1392)
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQ
SKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI
LKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLL
IHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPD
RVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRP
VGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID
TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAG
SIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYL
LQNSVKQYADVEGF
a.a.
length
InterPro Name
length(43), motif(1:43) 43 IPR012987 ROK, N-terminal [Domain]
length(73), motif(38:110) 73 IPR004088 K Homology domain, type 1 [Domain]
length(69), motif(41:109) 69 IPR004087 K Homology domain [Domain]
length(63), motif(42:104) 63 IPR004088 K Homology domain, type 1 [Domain]
length(59), motif(45:103) 59 IPR004088 K Homology domain, type 1 [Domain]
length(80), motif(141:220) 80 IPR004088 K Homology domain, type 1 [Domain]
length(80), motif(142:221) 80 IPR004088 K Homology domain, type 1 [Domain]
length(72), motif(143:214) 72 IPR004087 K Homology domain [Domain]
length(66), motif(144:209) 66 IPR004088 K Homology domain, type 1 [Domain]
length(63), motif(147:209) 63 IPR004088 K Homology domain, type 1 [Domain]
length(79), motif(379:457) 79 IPR004088 K Homology domain, type 1 [Domain]
length(74), motif(385:458) 74 IPR004088 K Homology domain, type 1 [Domain]
length(71), motif(386:456) 71 IPR004087 K Homology domain [Domain]
length(65), motif(387:451) 65 IPR004088 K Homology domain, type 1 [Domain]
length(62), motif(389:450) 62 IPR004088 K Homology domain, type 1 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000487603
H-Inv cluster ID Locus viewHIX0008131
Accession number AB451390.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Heterogeneous nuclear ribonucleoprotein K isoform a.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_002131)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ HNRNPK
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000051001
No. of interaction 18
Interaction partner(s) HIP000022035HIP000022049HIP000022971HIP000022971HIP000023960HIP000025001HIP000030471HIP000039590HIP000039653HIP000040680HIP000057536HIP000058310HIP000064456HIP000076215HIP000076215HIP000079240HIP000091500HIP000095024
BIND 145824;  177285;  177286;  19219;  24463;  24472;  263126;  50116;  50117;  50266;  54906;  57935;  57936;  57937;  57938; 
DIP 102592E;  111677E;  111706E;  112072E;  144758E;  151748E;  151750E;  151752E;  175753E;  179997E;  185077E;  185374E; 
MINT MINT-2855592;  MINT-2859739;  MINT-2859758;  MINT-2859777;  MINT-3296872;  MINT-5205854;  MINT-6803834;  MINT-6803853;  MINT-6803869;  MINT-6803896;  MINT-6803939;  MINT-6823857;  MINT-6823877;  MINT-7035260;  MINT-7035286;  MINT-7035298;  MINT-7035309;  MINT-7035323;  MINT-7035338;  MINT-7945693;  MINT-7947479;  MINT-8200625;  MINT-8200636;  MINT-8200651;  MINT-8201404;  MINT-8201427;  MINT-8201449; 
HPRD 00146;  00298;  00496;  00535;  00579;  00589;  00655;  00796;  01095;  01228;  01284;  01301;  01501;  01726;  01746;  01801;  01818;  01819;  02186;  02511;  02877;  03128;  03129;  03144;  03158;  03183;  03926;  04066;  04184;  04205;  04207;  04257;  04340;  04360;  04530;  05059;  05088;  05156;  05270;  05378;  05496;  06515;  06691;  07601;  09045;  09060;  09113;  09273;  10007;  11303;  11488;  11535;  12048;  12752;  13775;  14358;  15334;  15998;  16246;  17835;  18043; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:3190
KEGG GENES KEGG GENES(3190)
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function nucleic acid binding (GO:0003676);  RNA binding (GO:0003723); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
40 110 2axyA1 3e-10 29.6 71/71 d.51.1.1
144 251 2dp9A1 2e-17 11.0 100/120 b.122.1.5
384 457 1we8A 2e-04 17.1 74/104 d.51.1.1
Related H-InvDB links GTOP GTOP

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
6 .. 6 A/G rs202064506 - CDS Synonymous[Glu2Glu]
16 .. 16 C/T rs150076109 - CDS Nonsynonymous[Pro6Ser]
45 .. 45 C/T rs199952772 - CDS Synonymous[Thr15Thr]
72 .. 72 A/C rs114536498 - CDS Synonymous[Ala24Ala]
75 .. 75 A/G rs11548845 + CDS Synonymous[Glu25Glu]
243 .. 243 C/T rs201251896 - CDS Synonymous[Ser81Ser]
321 .. 321 C/T rs11548846 + CDS Synonymous[Thr107Thr]
386 .. 386 C/G rs140707980 - CDS Nonsynonymous[Ala129Gly]
435 .. 435 C/T rs116557087 - CDS Synonymous[Cys145Cys]
519 .. 519 C/T rs143811423 - CDS Synonymous[Asn173Asn]
528 .. 528 C/G rs201881795 - CDS Synonymous[Thr176Thr]
593 .. 593 A/G rs111725016 - CDS Nonsynonymous[Lys198Arg]
690 .. 690 C/T rs200783060 - CDS Synonymous[Tyr230Tyr]
984 .. 984 A/G rs140679593 - CDS Synonymous[Arg328Arg]
1062 .. 1062 A/T rs114279043 - CDS Synonymous[Pro354Pro]
1102 .. 1102 G/C rs182293768 - CDS Nonsynonymous[Gly368Arg]
1119 .. 1119 T/C rs143712714 - CDS Synonymous[Tyr373Tyr]
1140 .. 1140 T/C rs181141777 - CDS Synonymous[Tyr380Tyr]
1206 .. 1206 T/C rs115527397 - CDS Synonymous[Ile402Ile]
1236 .. 1236 A/G rs61755088 - CDS Synonymous[Gln412Gln]
1290 .. 1290 C/T rs115346013 - CDS Synonymous[Ser430Ser]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer