H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000488949 Accession number: AK294325 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to GTP-binding protein 10 isoform 1.
 
 

Motif information
ORF

length(308),orf(28:954)
MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQ
NRMTLKQLKDRYPRKRFVAGVGANSKFPNAGKSSLLSCVSHAKPAIADYA
FTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQ
LLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNK
MDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTG
EGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTMSSTEPPSKHAV
TTSKMDII*
a.a.
length
InterPro Name
length(66), motif(14:79) 66 IPR006169 GTP1/OBG domain [Domain]
length(21), motif(72:92) 21 IPR006073 GTP binding domain [Domain]
length(129), motif(77:205) 129 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(196), motif(77:272) 196 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]
length(123), motif(78:200) 123 IPR006073 GTP binding domain [Domain]
length(19), motif(93:111) 19 IPR006073 GTP binding domain [Domain]
length(16), motif(121:136) 16 IPR006073 GTP binding domain [Domain]
length(19), motif(138:156) 19 IPR006073 GTP binding domain [Domain]
length(37), motif(239:275) 37 IPR027417 P-loop containing nucleoside triphosphate hydrolase [Domain]