H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000502961 Accession number: BC144555 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Mitogen-activated protein kinase kinase kinase 19; EC=2.7.11.1; Regulated in COPD, protein kinase; SPS1/STE20-related protein kinase YSK4;
 
 

Transcript original information
Accession number BC144555.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:9053083
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (MAP3K19) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (MAP3K19);
Sequence data provider NA
Annotation project NA
Length of cDNA 1453[bp] (No. of exon:8)[A:439 T:369 G:338 C:307]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Pooled, cerebellum, kidney, placenta, testis, lung, colon, liver, heart, thyroid, bladder, uterus, PCR rescued clones
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0002473
Genomic location  G-integra Help Chromosome 2
Location 2q21.3
Position 135722380- 135782247
Strand -
Possible duplicated location(s) NA
Gene structure 8 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:80122
KEGG GENES KEGG GENES(80122)
GeneCard GeneCardMAP3K19*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000259495
Predicted CDS 31..1413;  460[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.718
Database links RefSeq NA
UniProt NA
CCDS CCDS63021

Motif information
ORF

length(460),orf(31:1413)
MSSMPKPERHAESLLDICHDTNSSPTDLMTVTKNQNIILQSISRSEEFDQ
DGDCSHSTLVNEEEDPSGGRQDWQPRTEGVEITVTFPRDVSPPQEMSQED
LKEKNLINSSLQEWAQAHAVSHPNEIETVELRKKKLTMRPLVLQKEESSR
ELCNVNLGFLLPRSCLELNISKSVTREDAPHFLKEQQRKSEEFSTSHMKY
SGRSIKVYCGLTSQGQLIAVKQVALDTSNKLAAEKEYRKLQEEVDLLKAL
KHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRFGPLPEMVFCKYTK
QILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNG
THSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLA
SMDRMAAMFYIGAHRGLMPPLPDHFSENAADFVRMCLTRDQHERPSALQL
LKHSFLERSH*
a.a.
length
InterPro Name
length(264), motif(193:456) 264 IPR000719 Protein kinase domain [Domain]
length(258), motif(199:456) 258 IPR002290 Serine/threonine/dual specificity protein kinase, catalytic domain [Domain]
length(252), motif(206:457) 252 IPR011009 Protein kinase-like domain [Domain]
length(251), motif(206:456) 251 IPR000719 Protein kinase domain [Domain]
length(13), motif(314:326) 13 IPR008271 Serine/threonine-protein kinase, active site [Active_site]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000502961
H-Inv cluster ID Locus viewHIX0002473
Accession number BC144555.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Mitogen-activated protein kinase kinase kinase 19; EC=2.7.11.1; Regulated in COPD, protein kinase; SPS1/STE20-related protein kinase YSK4;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q56UN5)  [Identity/coverage = 100.0%/15.51%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 14702039154893341581562117344846ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol MAP3K19
HGNC aliases "Yeast Sps1/Ste20-related kinase 4 (S. cerevisiae)", "yeast Sps1/Ste20-related kinase 4 (S. cerevisiae)", "YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae)"
HGNC name mitogen-activated protein kinase kinase kinase 19
DDBJ YSK4
UniProt MAP3K19
EC number EC 2.7.11.1non-specific serine/threonine protein kinase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 04150 :mTOR signaling pathway;  04210 :Apoptosis;  04310 :Wnt signaling pathway;  04320 :Dorso-ventral axis formation;  04340 :Hedgehog signaling pathway;  04350 :TGF-beta signaling pathway;  04360 :Axon guidance;  04370 :VEGF signaling pathway;  04510 :Focal adhesion;  04520 :Adherens junction;  04530 :Tight junction;  04540 :Gap junction;  04620 :Toll-like receptor signaling pathway;  04630 :Jak-STAT signaling pathway;  04660 :T cell receptor signaling pathway;  04662 :B cell receptor signaling pathway;  04664 :Fc epsilon RI signaling pathway;  04720 :Long-term potentiation;  04730 :Long-term depression;  04810 :Regulation of actin cytoskeleton;  04910 :Insulin signaling pathway;  04912 :GnRH signaling pathway;  04920 :Adipocytokine signaling pathway;  05010 :Alzheimer's disease;  05210 :Colorectal cancer; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000259495
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:80122
KEGG GENES KEGG GENES(80122)
GeneCard GeneCardMAP3K19*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transferase activity, transferring phosphorus-containing groups (GO:0016772);  ATP binding (GO:0005524);  protein kinase activity (GO:0004672); 
Biological process protein amino acid phosphorylation (GO:0006468); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
130 457 1nw1A 1e-43 7.2 321/365 d.144.1.8
Related H-InvDB links GTOP GTOP

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
112 .. 112 T/C rs147672857 - CDS Synonymous[Leu28Leu]
125 .. 125 C/A rs75648600 - CDS Nonsynonymous[Thr32Asn]
185 .. 185 G/A rs147635402 - CDS Nonsynonymous[Gly52Asp]
237 .. 237 T/C rs113061226 - CDS Synonymous[Gly69Gly]
286 .. 286 T/C rs151183639 - CDS Nonsynonymous[Phe86Leu]
330 .. 330 C/G rs148040063 - CDS Nonsynonymous[Asp100Glu]
365 .. 365 A/C rs201841965 - CDS Nonsynonymous[Gln112Pro]
402 .. 402 T/C rs145950712 - CDS Synonymous[Asn124Asn]
406 .. 406 A/T rs6715812 - CDS Nonsynonymous[Ile126Leu]
413 .. 413 C/T rs151112282 - CDS Nonsynonymous[Thr128Met]
445 .. 445 C/T rs141899370 - CDS Nonsynonymous[Arg139Trp]
446 .. 446 G/A rs147043490 - CDS Nonsynonymous[Arg139Gln]
455 .. 455 T/A rs190387950 - CDS Nonsynonymous[Val142Asp]
458 .. 458 T/A rs138992614 - CDS AA-STOP[Leu143*]
468 .. 468 G/A rs113569095 - CDS Synonymous[Glu146Glu]
534 .. 534 G/A rs6754977 - CDS Synonymous[Leu168Leu]
558 .. 558 A/G rs146453631 - CDS Synonymous[Arg176Arg]
571 .. 571 C/T rs150706097 - CDS Nonsynonymous[His181Tyr]
742 .. 742 C/T rs192434665 - CDS Nonsynonymous[Arg238Trp]
887 .. 887 G/A rs56349597 - CDS Nonsynonymous[Arg286His]
927 .. 927 G/A rs200267339 - CDS Synonymous[Thr299Thr]
975 .. 975 A/C rs201993219 - CDS Synonymous[Val315Val]
979 .. 979 C/T rs142199742 - CDS Nonsynonymous[Arg317Cys]
980 .. 980 G/A rs145092752 - CDS Nonsynonymous[Arg317His]
1019 .. 1019 G/A rs145246801 - CDS Nonsynonymous[Gly330Glu]
1022 .. 1022 T/C rs56284052 - CDS Nonsynonymous[Ile331Thr]
1048 .. 1048 G/T rs200326947 - CDS Nonsynonymous[Ala340Ser]
1162 .. 1162 C/T rs139473560 - CDS Nonsynonymous[Arg378Trp]
1232 .. 1232 C/T rs147832465 - CDS Nonsynonymous[Ser401Phe]
1240 .. 1240 A/G rs140447534 - CDS Nonsynonymous[Arg404Gly]
1263 .. 1263 C/T rs149473090 - CDS Synonymous[Ile411Ile]
1271 .. 1271 A/G rs186711668 - CDS Nonsynonymous[His414Arg]
1353 .. 1353 G/C rs150711518 - CDS Nonsynonymous[Gln441His]
1394 ^ 1395 -/G rs34667488 - CDS
1404 .. 1404 A/T rs142282210 - CDS Nonsynonymous[Arg458Ser]
1419 .. 1419 C/T rs187643783 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer