H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000503051 Accession number: BC144652 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to C-type lectin domain family 4 member F isoform 2.
 
 

Motif information
ORF

length(557),orf(32:1705)
MDGEAVRFCTDNQCVSLHPQEVDSVAMAPAAPKIPRLVQATPAFMAVTLV
FSLVTLFVVVQQQTRPVPKPVQAVILGDNITGHLPFEPNNHHHFGREAEM
RELIQTFKGHMENSSAWVVEIQMLKCRVDNVNSQLQVLGDHLGNTNADIQ
MVKGVLKDATTLSLQTQMLRSSLEGTNAEIQRLKEDLEKADALTFQTLNF
LKSSLENTSIELHVLSRGLENANSEIQMLNASLETANTQAQLANSSLKNA
NAEIYVLRGHLDSVNDLRTQNQVLRNSLEGANAEIQGLKENLQNTNALNS
QTQAFIKSSFDNTSAEIQFLRGHLERAGDEIHVLKRDLKMVTAQTQKANG
RLDQTDTQIQVFKSEMENVNTLNAQIQVLNGHMKNASREIQTLKQGMKNA
SALTSQTQMLDSNLQKASAEIQRLRGDLENTKALTMEIQQEQSRLKTLHV
VITSQEQLQRTQSQLLQMVLQGWKFNGGSLYYFSSVKKSWHEAEQFCVSQ
GAHLASVASKEEQAFLVEFTSKVYYWIGLTDRGTEGSWRWTDGTPFNAAQ
NKAATRG*
a.a.
length
InterPro Name
length(100), motif(450:549) 100 IPR016186 C-type lectin-like [Domain]
length(94), motif(456:549) 94 IPR016187 C-type lectin fold [Domain]
length(84), motif(469:552) 84 IPR001304 C-type lectin [Domain]
length(72), motif(476:547) 72 IPR001304 C-type lectin [Domain]
length(64), motif(487:550) 64 IPR001304 C-type lectin [Domain]