H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000721553 Accession number: JQ790620 Created date: 20-May-2015 Last modified: 27-May-2015
Definition: Similar to Leucine-rich repeat-containing protein 37B precursor.
 
 

Motif information
ORF

length(253),orf(3:763)
ALTAPEEQKASTSTNICELCTCGDETLSCVGLSPKQRLRQVPVPEPDTYN
GIFTTLNFQGNYISYLDGNVWKAYSWTEKLILSENYLTELPKDSFEGLLY
LQYLDLSCNKIRYIERQTFESLPFLQYINLGCNLITKLSLGTFQAWHGMQ
FLHNLILNRNPLTTVEDPYLFELPALKYLDMGTTHITLTTLKNILTMTVE
LEKLILPSHMACCLCQFKNSIEAVCKTVKLHCNTACLTNSIHCPEEESVG
NPE
a.a.
length
InterPro Name
length(22), motif(76:97) 22 IPR001611 Leucine-rich repeat [Repeat]
length(20), motif(78:97) 20 IPR003591 Leucine-rich repeat, typical subtype [Repeat]
length(58), motif(78:135) 58 IPR001611 Leucine-rich repeat [Repeat]
length(24), motif(98:121) 24 IPR003591 Leucine-rich repeat, typical subtype [Repeat]
length(22), motif(100:121) 22 IPR001611 Leucine-rich repeat [Repeat]
length(24), motif(122:145) 24 IPR003591 Leucine-rich repeat, typical subtype [Repeat]
length(22), motif(124:145) 22 IPR001611 Leucine-rich repeat [Repeat]
length(25), motif(149:173) 25 IPR003591 Leucine-rich repeat, typical subtype [Repeat]
length(22), motif(151:172) 22 IPR001611 Leucine-rich repeat [Repeat]