H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000721555 Accession number: JQ790622 Created date: 20-May-2015 Last modified: 27-May-2015
Definition: Similar to Leucine-rich repeat-containing protein 37B precursor.
 
 

Transcript original information
Accession number JQ790622.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (LRRC37B) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (LRRC37B);
Sequence data provider NA
Annotation project NA
Length of cDNA 751[bp] (No. of exon:9)[A:241 T:195 G:140 C:175]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type cerebellum
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N/C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0039097
Genomic location  G-integra Help Chromosome 17
Location 17q11.2
Position 30349688- 30374810
Strand +
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard GeneCardLRRC37B*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000530803
Predicted CDS 3..751;  249[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.713

Motif information
ORF

length(249),orf(3:751)
PEEQKASTSTNICELCTCGDETLSCVGLSPKQRLRQVPVPEPDTYNGIFT
TLNFQGNYISYLDGNVWKAYSWTEKLILSENYLTELPKDSFEGLLYLQYL
DLSCNKIRYIERQTFESLPFLQYINLGCNLITKLSLGTFQAWHGMQFLHN
LILNRNPLTTVEDPYLFELPALKYLDMGTTHITLTTLKNILTMTVELEKL
ILPSHMACCLCQFKNSIEAVCKTVKLHCNTACLTNSIHCPEEESVGNPE
a.a.
length
InterPro Name
length(22), motif(72:93) 22 IPR001611 Leucine-rich repeat [Repeat]
length(20), motif(74:93) 20 IPR003591 Leucine-rich repeat, typical subtype [Repeat]
length(58), motif(74:131) 58 IPR001611 Leucine-rich repeat [Repeat]
length(24), motif(94:117) 24 IPR003591 Leucine-rich repeat, typical subtype [Repeat]
length(22), motif(96:117) 22 IPR001611 Leucine-rich repeat [Repeat]
length(24), motif(118:141) 24 IPR003591 Leucine-rich repeat, typical subtype [Repeat]
length(22), motif(120:141) 22 IPR001611 Leucine-rich repeat [Repeat]
length(25), motif(145:169) 25 IPR003591 Leucine-rich repeat, typical subtype [Repeat]
length(22), motif(147:168) 22 IPR001611 Leucine-rich repeat [Repeat]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000721555
H-Inv cluster ID Locus viewHIX0039097
Accession number JQ790622.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Leucine-rich repeat-containing protein 37B precursor.
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (NP_443120)  [Identity/coverage = 99.598%/26.29%] to Homo sapiens protein.
Experimental evidence NA
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol LRRC37B
HGNC aliases NA
HGNC name leucine rich repeat containing 37B
DDBJ NA
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000530803
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard GeneCardLRRC37B*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function protein binding (GO:0005515); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  extracellular;  nuclear;  Other; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
1 .. 1 C/T rs148524381 + 5'UTR
6 .. 6 G/C rs142826230 + CDS Nonsynonymous[Glu2Gln]
27 .. 27 A/G rs58002156 - CDS Nonsynonymous[Ser9Gly]
50 .. 50 C/T rs1044847 + CDS Synonymous[Cys16Cys]
56 .. 56 C/T rs146053152 + CDS Synonymous[Cys18Cys]
69 .. 69 C/G rs1044849 + CDS Nonsynonymous[Leu23Val]
78 .. 78 G/A rs1044850 + CDS Nonsynonymous[Val26Ile]
82 .. 82 G/A rs1044851 + CDS Nonsynonymous[Gly27Asp]
88 .. 88 G/A rs1044852 + CDS Nonsynonymous[Ser29Asn]
93 .. 93 A/G rs1044853 + CDS Nonsynonymous[Lys31Glu]
128 .. 128 C/G rs201331452 + CDS Synonymous[Pro42Pro]
131 .. 131 C/T rs139457390 + CDS Synonymous[Asp43Asp]
176 .. 176 T/C rs144144091 + CDS Synonymous[Tyr58Tyr]
186 .. 186 C/A rs199689901 + CDS Nonsynonymous[Leu62Ile]
186 .. 186 C/A rs569874 + CDS Nonsynonymous[Leu62Ile]
224 ^ 225 -/G rs35825325 + CDS
262 .. 262 C/A rs146503923 + CDS Nonsynonymous[Pro87His]
262 .. 262 C/A rs2449791 - CDS Nonsynonymous[Pro87His]
289 .. 289 A/C rs2449790 - CDS Nonsynonymous[Tyr96Ser]
326 .. 326 A/G rs147021701 + CDS Synonymous[Arg108Arg]
329 .. 329 T/C rs41290974 - CDS Synonymous[Tyr109Tyr]
341 .. 341 A/T rs201577424 + CDS Nonsynonymous[Gln113His]
341 .. 341 A/T rs471887 - CDS Nonsynonymous[Gln113His]
351 .. 351 T/C rs79829378 + CDS Nonsynonymous[Ser117Pro]
373 .. 373 T/C rs9902553 - CDS Nonsynonymous[Ile124Thr]
398 .. 398 A/G rs145531116 + CDS Synonymous[Thr132Thr]
399 .. 399 A/G rs201006374 + CDS Nonsynonymous[Lys133Glu]
407 .. 407 C/T rs148845002 + CDS Synonymous[Ser135Ser]
461 .. 461 C/G/T rs112535435 + CDS
465 .. 465 C/T rs202063240 + CDS Nonsynonymous[Arg155Cys]
483 .. 483 G/A rs137899779 + CDS Nonsynonymous[Val161Ile]
486 .. 486 G/A rs141921890 + CDS Nonsynonymous[Glu162Lys]
494 .. 494 A/C rs201112439 + CDS Synonymous[Pro164Pro]
559 .. 559 C/T rs146905900 + CDS Nonsynonymous[Thr186Ile]
622 .. 622 C/T rs1638299 - CDS Nonsynonymous[Ala207Val]
670 .. 670 C/G rs139322675 + CDS Nonsynonymous[Thr223Arg]
686 .. 686 C/T rs199662103 + CDS Synonymous[Cys228Cys]
690 .. 690 A/T rs139560584 + CDS Nonsynonymous[Thr230Ser]
697 .. 697 G/A rs201551794 + CDS Nonsynonymous[Cys232Tyr]
727 .. 727 A/C rs138060086 + CDS Nonsynonymous[Glu242Ala]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer